PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_E5C380F21.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 697aa    MW: 80878.3 Da    PI: 8.1411
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_E5C380F21.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.58.1e-271198190
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                           +fYn YA++vGF vr+s+  ++++n  it+rtfvCs+eg+re++k + ++++ +r+etr+gC a+++++++ +gk+++t+++ +HnH+la
  Traes_2BL_E5C380F21.1 11 EFYNIYAEKVGFFVRRSTLWTTSKNI-ITRRTFVCSREGFREKKKGA-KESKCPRPETRIGCPASMTIRLTPNGKYRLTEFVPNHNHQLA 98
                           6********************97766.****************9999.9999************************************97 PP

2FAR180.72.6e-25140225188
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY+ YA ++GF+vr+++++ +  ++ it+r fvCskeg+re+++ + ++ +++r+etrtgC a++++++ ++gk++vt++++ HnH 
  Traes_2BL_E5C380F21.1 140 EFYSMYAGKIGFNVRRASMTVN-AENVITRRMFVCSKEGFREKKRGA-NRVKKPRPETRTGCPACMVIRLASNGKYNVTEFVTFHNHG 225
                            6****************99998.5566****************9998.9**************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.6E-241198IPR004330FAR1 DNA binding domain
PfamPF031011.9E-21140225IPR004330FAR1 DNA binding domain
PfamPF105516.1E-23337431IPR018289MULE transposase domain
PROSITE profilePS5096610.892605652IPR007527Zinc finger, SWIM-type
PfamPF044345.4E-9605651IPR007527Zinc finger, SWIM-type
SMARTSM005752.7E-6627654IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MLFDDENDAY EFYNIYAEKV GFFVRRSTLW TTSKNIITRR TFVCSREGFR EKKKGAKESK  60
CPRPETRIGC PASMTIRLTP NGKYRLTEFV PNHNHQLATA STIHMLKAKK IRRKARAVRE  120
NLVDDTVVTP EFENEDEAYE FYSMYAGKIG FNVRRASMTV NAENVITRRM FVCSKEGFRE  180
KKRGANRVKK PRPETRTGCP ACMVIRLASN GKYNVTEFVT FHNHGXXXXX XXSLTAGSYQ  240
DCGVDLYDEA LDDCYGKQNL IKDDATSNCL EGRSWKRYKC KVPHYGDVGA TLEYLQKMQH  300
DNPSFFYAVK SDEDGNLTNF LWADSKSIMD FTHFGDVVCL DSGYEVQGYG RPIALFTGLN  360
HHRQTVIFGT ALLYDESFEA FRWLFDTFKM AMNSTHPKTL LTDRSAVISE AVAVSWPETA  420
HRFCVWQIYQ NALQQLSQAF HGSRTLEYNF KRCLFDCEDE AEFLMAWREM LENHDLKDNQ  480
WLADLLAVKE KWALPYGREA FYADMKSVQQ KDNLSSELKI YLSLEFDLLS FFVQFEKLLC  540
DRRSAELQLD VSASQSTKKP PSMRILRQAA NVYTPAAYRM FEREFELYMD CMLYNCGEMG  600
TICEYRITVE DNPKDHFVKY DSLNSMSHCS CKRFEFVGIP CRHMLKVLDT RNIKDIPPQY  660
ILKRWRKDAR SGSSNGGYAY SFDGDPQTKR HTLLCRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3766160.0AK376616.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3129B22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753080.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5BGJ10.0W5BGJ1_WHEAT; Uncharacterized protein
STRINGMLOC_76708.60.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-105FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]